Lineage for d1nman_ (1nma N:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 114090Fold b.68: 6-bladed beta-propeller [50938] (7 superfamilies)
  4. 114091Superfamily b.68.1: Sialidases (neuraminidases) [50939] (1 family) (S)
  5. 114092Family b.68.1.1: Sialidases (neuraminidases) [50940] (6 proteins)
  6. 114093Protein Influenza neuraminidase [50943] (2 species)
  7. 114094Species Influenza A virus, different strains [TaxId:11320] [50944] (45 PDB entries)
  8. 114142Domain d1nman_: 1nma N: [27590]
    Other proteins in same PDB: d1nmah_, d1nmal_

Details for d1nman_

PDB Entry: 1nma (more details), 3 Å

PDB Description: n9 neuraminidase complexes with antibodies nc41 and nc10: empirical free-energy calculations capture specificity trends observed with mutant binding data

SCOP Domain Sequences for d1nman_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nman_ b.68.1.1 (N:) Influenza neuraminidase {Influenza A virus, different strains}
refnnltkglctinswhiygkdnavrigedsdvlvtrepyvscdpdecrfyalsqgttir
gkhsngtihdrsqyrdliswplsspptvynsrvecigwsstschdgrarmsicisgpnnn
asaviwynrrpvteintwarnilrtqesecvcqngvcpvvftdgsatgpaetriyyfkeg
kilkwepltgtakhieecscygeqagvtctcrdnwqgsnrpviqidpvamthtsqyicsp
vltdnprpndptvgkcndpypgnnnngvkgfsyldggntwlgrtisiasrsgyemlkvpn
altddksrptqgqtivlntdwsgysgsfmdywaegecyracfyvelirgrpkedkvwwts
nsivsmcssteflgqwnw

SCOP Domain Coordinates for d1nman_:

Click to download the PDB-style file with coordinates for d1nman_.
(The format of our PDB-style files is described here.)

Timeline for d1nman_: