Class b: All beta proteins [48724] (180 folds) |
Fold b.7: C2 domain-like [49561] (5 superfamilies) sandwich; 8 strands in 2 sheets; greek-key |
Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (4 families) two constituent families are related by circular permutation |
Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (11 proteins) topologically similar to the C-terminal domain of PapD |
Protein Synaptogamin I [49576] (3 species) duplication: contains tandem repeat of two similar domains |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [49577] (12 PDB entries) Uniprot P21707 271-419 ! Uniprot P21707 271-419 |
Domain d5ccjd1: 5ccj D:271-421 [275849] Other proteins in same PDB: d5ccjd2 automated match to d2lhaa_ complexed with gol, so4; mutant |
PDB Entry: 5ccj (more details), 1.65 Å
SCOPe Domain Sequences for d5ccjd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ccjd1 b.7.1.2 (D:271-421) Synaptogamin I {Norway rat (Rattus norvegicus) [TaxId: 10116]} eklgdicfslayvptagkltvvilaaknlkkmdvgglsdpyvkihlmqngkrlkkkktti kkntlnpwynesfsfevpfeqiqkvqvvvtvldydkigkndaigkvfvgynstgaelrhw sdmlanpaapiaqwhtlqveeevdamlavkk
Timeline for d5ccjd1: