Lineage for d5br0c_ (5br0 C:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1778087Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 1778088Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 1778695Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 1778696Protein automated matches [227017] (23 species)
    not a true protein
  7. 1778753Species Influenza a virus (a/taiwan/2/2013 (h6n1)) [TaxId:11320] [275830] (1 PDB entry)
  8. 1778755Domain d5br0c_: 5br0 C: [275834]
    Other proteins in same PDB: d5br0b_, d5br0d_
    automated match to d3htta_
    complexed with bma, fuc, man, nag

Details for d5br0c_

PDB Entry: 5br0 (more details), 2.39 Å

PDB Description: crystal structure of hemagglutinin of a/taiwan/2/2013 (h6n1)
PDB Compounds: (C:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d5br0c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5br0c_ b.19.1.0 (C:) automated matches {Influenza a virus (a/taiwan/2/2013 (h6n1)) [TaxId: 11320]}
dkicigyhannsttqvdtlleknvtvthsvellenqkekrfckimnkapldlkdctiegw
ilgnpkcdlllgdqswsyiverpnaqngicypgvlneleelkafigsgerverfemfpks
twagvdtsrgvtnacpsytidssfyrnlvwivktdsatypvikgtynntgtqpilyfwgv
hhpldttvqdnlygsgdkyvrmgtesmnfakspeiaarpavngqrsridyywsvlrpget
lnvesngnliapwyaykfvstnkkgavfksdlpiencdatcqtitgvlrtnktfqnvspl
wigecpkyvkseslrlatglrnvpqi

SCOPe Domain Coordinates for d5br0c_:

Click to download the PDB-style file with coordinates for d5br0c_.
(The format of our PDB-style files is described here.)

Timeline for d5br0c_: