Lineage for d1nmbn_ (1nmb N:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 62715Fold b.68: 6-bladed beta-propeller [50938] (6 superfamilies)
  4. 62716Superfamily b.68.1: Sialidases (neuraminidases) [50939] (1 family) (S)
  5. 62717Family b.68.1.1: Sialidases (neuraminidases) [50940] (6 proteins)
  6. 62718Protein Influenza neuraminidase [50943] (2 species)
  7. 62719Species Influenza A virus, different strains [TaxId:11320] [50944] (45 PDB entries)
  8. 62762Domain d1nmbn_: 1nmb N: [27583]
    Other proteins in same PDB: d1nmbh_, d1nmbl_

Details for d1nmbn_

PDB Entry: 1nmb (more details), 2.5 Å

PDB Description: the structure of a complex between the nc10 antibody and influenza virus neuraminidase and comparison with the overlapping binding site of the nc41 antibody

SCOP Domain Sequences for d1nmbn_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nmbn_ b.68.1.1 (N:) Influenza neuraminidase {Influenza A virus, different strains}
refnnltkglctinswhiygkdnavrigedsdvlvtrepyvscdpdecrfyalsqgttir
gkhsngtihdrsqyrdliswplsspptvynsrvecigwsstschdgrarmsicisgpnnn
asaviwynrrpvteintwarnilrtqesecvcqngvcpvvftdgsatgpaetriyyfkeg
kilkwepltgtakhieecscygeqagvtctcrdnwqgsnrpviqidpvamthtsqyicsp
vltdnprpndptvgkcndpypgnnnngvkgfsyldggntwlgrtisiasrsgyemlkvpn
altddrskptqgqtivlntdwsgysgsfmdywaegecyracfyvelirgrpkedkvwwts
nsivsmcssteflgqwnwpdgakieyfl

SCOP Domain Coordinates for d1nmbn_:

Click to download the PDB-style file with coordinates for d1nmbn_.
(The format of our PDB-style files is described here.)

Timeline for d1nmbn_: