SCOPe 2.05: Domain d5br6a_: 5br6 A:

Lineage for d5br6a_ (5br6 A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.0: automated matches [227246] (1 protein)
   not a true family

6. Protein automated matches [227017] (23 species)
   not a true protein

7. Species Influenza A virus [TaxId:11320] [228462] (15 PDB entries)

8. Domain d5br6a_: 5br6 A: [275827]
   Other proteins in same PDB: d5br6b_, d5br6d_
   automated match to d3htta_
   complexed with bma, fuc, gal, man, nag, sia

Details for d5br6a_

PDB Entry: 5br6, 2.43 Å

PDB Description: crystal structure of hemagglutinin of a/taiwan/2/2013 (h6n1) in complex with lstc

PDB Compounds: (A:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d5br6a_:

Sequence; same for both SEQRES and ATOM records:

>d5br6a_ b.19.1.0 (A:) automated matches {Influenza A virus [TaxId: 11320]}
dkicigyhannsttqvdtlleknvtvthsvellenqkekrfckimnkapldlkdctiegw
ilgnpkcdlllgdqswsyiverpnaqngicypgvlneleelkafigsgerverfemfpks
twagvdtsrgvtnacpsytidssfyrnlvwivktdsatypvikgtynntgtqpilyfwgv
hhpldttvqdnlygsgdkyvrmgtesmnfakspeiaarpavngqrsridyywsvlrpget
lnvesngnliapwyaykfvstnkkgavfksdlpiencdatcqtitgvlrtnktfqnvspl
wigecpkyvkseslrlatglrnvpqi

Timeline for d5br6a_:

• d5br6a_ is new in SCOPe 2.05-stable
  
• d5br6a_ appears in SCOPe 2.06
  
• d5br6a_ appears in the current release, SCOPe 2.08