Lineage for d5bnyd_ (5bny D:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3040825Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 3041799Family h.3.1.0: automated matches [254278] (1 protein)
    not a true family
  6. 3041800Protein automated matches [254645] (42 species)
    not a true protein
  7. 3041823Species Influenza A virus (a/chicken/guangdong/s1311/2010(h6n6)) [TaxId:1454272] [275804] (6 PDB entries)
  8. 3041826Domain d5bnyd_: 5bny D: [275808]
    Other proteins in same PDB: d5bnya_, d5bnyc_, d5bnye_
    automated match to d4d00d_
    complexed with nag

Details for d5bnyd_

PDB Entry: 5bny (more details), 2.66 Å

PDB Description: crystal structure of hemagglutinin of a/chicken/guangdong/s1311/2010 (h6n6)
PDB Compounds: (D:) Hemagglutinin

SCOPe Domain Sequences for d5bnyd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5bnyd_ h.3.1.0 (D:) automated matches {Influenza A virus (a/chicken/guangdong/s1311/2010(h6n6)) [TaxId: 1454272]}
glfgaiagfieggwtgmidgwygyhhensqgsgyaadkestqkaidgitnkvnsiidkmn
tqfeavghefsnlerridnlnkrmedgfldvwtynaellvllenertldlhdanvknlhe
kvrsqlrdnandlgngcfefwhkcnnecmesvkngtydypkyqkesrlnrqki

SCOPe Domain Coordinates for d5bnyd_:

Click to download the PDB-style file with coordinates for d5bnyd_.
(The format of our PDB-style files is described here.)

Timeline for d5bnyd_: