SCOPe 2.05: Domain d5a00a2: 5a00 A:797-1010

Lineage for d5a00a2 (5a00 A:797-1010)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.166: ADP-ribosylation [56398] (1 superfamily)
   unusual fold

4. Superfamily d.166.1: ADP-ribosylation [56399] (8 families)

5. Family d.166.1.0: automated matches [191650] (1 protein)
   not a true family

6. Protein automated matches [191197] (7 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225406] (26 PDB entries)

8. Domain d5a00a2: 5a00 A:797-1010 [275799]
   Other proteins in same PDB: d5a00a1
   automated match to d4gv2a2
   complexed with d7n, so4

Details for d5a00a2

PDB Entry: 5a00, 2.75 Å

PDB Description: structure of human parp1 catalytic domain bound to an isoindolinone inhibitor

PDB Compounds: (A:) Poly [ADP-ribose] polymerase 1

SCOPe Domain Sequences for d5a00a2:

Sequence; same for both SEQRES and ATOM records:

>d5a00a2 d.166.1.0 (A:797-1010) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lktdikvvdrdseeaeiirkyvknthatthnaydlevidifkieregecqrykpfkqlhn
rrllwhgsrttnfagilsqglriappeapvtgymfgkgiyfadmvsksanychtsqgdpi
glillgevalgnmyelkhashisklpkgkhsvkglgkttpdpsanisldgvdvplgtgis
sgvndtsllyneyivydiaqvnlkyllklkfnfk

Timeline for d5a00a2:

• d5a00a2 is new in SCOPe 2.05-stable
  
• d5a00a2 appears in SCOPe 2.06
  
• d5a00a2 appears in the current release, SCOPe 2.08