Lineage for d1ivga_ (1ivg A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2417088Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2417089Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 2417090Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 proteins)
  6. 2417103Protein Influenza neuraminidase [50943] (8 species)
  7. 2417150Species Influenza A virus, different strains [TaxId:11320] [50944] (89 PDB entries)
    Uniprot P03472 84-470
  8. 2417195Domain d1ivga_: 1ivg A: [27578]
    complexed with ca

Details for d1ivga_

PDB Entry: 1ivg (more details), 1.9 Å

PDB Description: structures of aromatic inhibitors of influenza virus neuraminidase
PDB Compounds: (A:) influenza a subtype n2 neuraminidase

SCOPe Domain Sequences for d1ivga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ivga_ b.68.1.1 (A:) Influenza neuraminidase {Influenza A virus, different strains [TaxId: 11320]}
veyrnwskpqcqitgfapfskdnsirlsaggdiwvtrepyvscdpvkcyqfalgqgttld
nkhsndtvhdriphrtllmnelgvpfhlgtrqvciawsssschdgkawlhvcitgddkna
tasfiydgrlvdsigswsqnilrtqesecvcingtctvvmtdgsasgradtrilfieegk
ivhisplagsaqhveecscyprypgvrcicrdnwkgsnrpvvdinmedysidssyvcsgl
vgdtprnddrssnsncrdpnnergtqgvkgwafdngndlwmgrtiskdlrsgyetfkvig
gwstpnsksqinrqvivdsdnrsgysgifsvegkscinrcfyvelirgrkqetrvwwtsn
sivvfcgtsgtygtgswpdganinfmpi

SCOPe Domain Coordinates for d1ivga_:

Click to download the PDB-style file with coordinates for d1ivga_.
(The format of our PDB-style files is described here.)

Timeline for d1ivga_: