Lineage for d4ytpd_ (4ytp D:)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1957178Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
    core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices
  4. 1957267Superfamily f.21.2: Fumarate reductase respiratory complex transmembrane subunits [81343] (2 families) (S)
    two distinct families: in one family the common fold is contained in a single-chain subunit, in the other it is formed by two chains
  5. 1957285Family f.21.2.2: Succinate dehydrogenase/Fumarate reductase transmembrane subunits (SdhC/FrdC and SdhD/FrdD) [81373] (7 proteins)
    consists of two homologous non-identical subunits that form a heterodimer; may or may not contain heme groups
  6. 1957365Protein automated matches [254461] (3 species)
    not a true protein
  7. 1957387Species Pig (Sus scrofa) [TaxId:9823] [255743] (4 PDB entries)
  8. 1957391Domain d4ytpd_: 4ytp D: [275749]
    Other proteins in same PDB: d4ytpb1, d4ytpb2
    automated match to d1zoyd_
    complexed with e23, f3s, fad, fes, hem, sf4

Details for d4ytpd_

PDB Entry: 4ytp (more details), 3.1 Å

PDB Description: crystal structure of porcine heart mitochondrial complex ii bound with n-[(4-tert-butylphenyl)methyl]-2-(trifluoromethyl)benzamide
PDB Compounds: (D:) Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial

SCOPe Domain Sequences for d4ytpd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ytpd_ f.21.2.2 (D:) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
sskaaslhwtgervvsvlllgllpaaylnpcsamdyslaaaltlhghwgigqvvtdyvrg
dalqkvakagllalsaftfaglcyfnyhdvgickavamlwkl

SCOPe Domain Coordinates for d4ytpd_:

Click to download the PDB-style file with coordinates for d4ytpd_.
(The format of our PDB-style files is described here.)

Timeline for d4ytpd_: