SCOPe 2.08: Domain d4ytpb1: 4ytp B:9-114

Lineage for d4ytpb1 (4ytp B:9-114)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families)

5. Family d.15.4.0: automated matches [191632] (1 protein)
   not a true family

6. Protein automated matches [191164] (24 species)
   not a true protein

7. Species Pig (Sus scrofa) [TaxId:9823] [255742] (5 PDB entries)

8. Domain d4ytpb1: 4ytp B:9-114 [275745]
   Other proteins in same PDB: d4ytpb2, d4ytpd_
   automated match to d1zoyb1
   complexed with e23, f3s, fad, fes, hem, sf4

Details for d4ytpb1

PDB Entry: 4ytp, 3.1 Å

PDB Description: crystal structure of porcine heart mitochondrial complex ii bound with n-[(4-tert-butylphenyl)methyl]-2-(trifluoromethyl)benzamide

PDB Compounds: (B:) Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial

SCOPe Domain Sequences for d4ytpb1:

Sequence; same for both SEQRES and ATOM records:

>d4ytpb1 d.15.4.0 (B:9-114) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
prikkfaiyrwdpdktgdkphmqtyeidlnncgpmvldalikikneidstltfrrscreg
icgscamninggntlactrridtnldkvskiyplphmyvikdlvpd

Timeline for d4ytpb1:

• d4ytpb1 first appeared in SCOPe 2.05
  
• d4ytpb1 appears in SCOPe 2.07