SCOPe 2.06: Domain d4ysyf1: 4ysy F:33-138

Lineage for d4ysyf1 (4ysy F:33-138)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families)

5. Family d.15.4.0: automated matches [191632] (1 protein)
   not a true family

6. Protein automated matches [191164] (21 species)
   not a true protein

7. Species Pig roundworm (Ascaris suum) [TaxId:6253] [256141] (8 PDB entries)

8. Domain d4ysyf1: 4ysy F:33-138 [275739]
   Other proteins in same PDB: d4ysyb2, d4ysyf2
   automated match to d3vrbb1
   complexed with e24, eph, f3s, fad, fes, hem, mli, sf4

Details for d4ysyf1

PDB Entry: 4ysy, 3.1 Å

PDB Description: crystal structure of mitochondrial rhodoquinol-fumarate reductase from ascaris suum with n-[(2,4-dichlorophenyl)methyl]-2-(trifluoromethyl) benzamide

PDB Compounds: (F:) Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial

SCOPe Domain Sequences for d4ysyf1:

Sequence; same for both SEQRES and ATOM records:

>d4ysyf1 d.15.4.0 (F:33-138) automated matches {Pig roundworm (Ascaris suum) [TaxId: 6253]}
kriktfeiyrfnpeepgakpklqkfdvdldkcgtmvldalikiknevdptltfrrscreg
icgscamniagentlacicnidqntskttkiyplphmfvikdlvpd

Timeline for d4ysyf1:

• d4ysyf1 first appeared in SCOPe 2.05
  
• d4ysyf1 appears in SCOPe 2.07
  
• d4ysyf1 appears in the current release, SCOPe 2.08