SCOPe 2.08: Domain d4y7ma_: 4y7m A:

Lineage for d4y7ma_ (4y7m A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries)

8. Domain d4y7ma_: 4y7m A: [275723]
   automated match to d4grwe_
   complexed with so4

Details for d4y7ma_

PDB Entry: 4y7m, 1.92 Å

PDB Description: t6ss protein tssm c-terminal domain (835-1129) from eaec

PDB Compounds: (A:) Hi113 protein

SCOPe Domain Sequences for d4y7ma_:

Sequence; same for both SEQRES and ATOM records:

>d4y7ma_ b.1.1.1 (A:) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvqlvesggglvqaggslrlscaasgftfedyaigwfrqapgkeregvscisnldgstyy
pdsvkgrftassdkaknmvylqmnslkpedtavyycaavnaqgiyctdyiigpygmdywg
kgtqvtvss

Timeline for d4y7ma_:

• d4y7ma_ first appeared in SCOPe 2.05
  
• d4y7ma_ appears in SCOPe 2.07