Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) |
Family c.1.4.0: automated matches [191310] (1 protein) not a true family |
Protein automated matches [190048] (31 species) not a true protein |
Species Pseudomonas putida [TaxId:303] [187793] (24 PDB entries) |
Domain d4utma_: 4utm A: [275689] automated match to d3l65a_ complexed with 8cm, fnr, so4 |
PDB Entry: 4utm (more details), 1.09 Å
SCOPe Domain Sequences for d4utma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4utma_ c.1.4.0 (A:) automated matches {Pseudomonas putida [TaxId: 303]} salfepytlkdvtlrnriaippmcqymaedgmindwhhvhlaglarggagllvveatava pegritpgcagiwsdahaqafvpvvqaikaagsvpgiqiahagrkasanrpwegddhiaa ddtrgwetiapsaiafgahlpkvpremtlddiarvkqdfvdaarrardagfewielhfah gflgqsffsehsnkrtdayggsfdnrsrflletlaavrevwpenlpltarfgvleydgrd eqtleesielarrfkaggldllsvsvgftipdtnipwgpafmgpiaervrreaklpvtsa wgfgtpqlaeaalqanqldlvsvgrahladphwayfaakelgvekaswtlpapyahwler
Timeline for d4utma_: