Lineage for d1ivda_ (1ivd A:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 674916Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 674917Superfamily b.68.1: Sialidases [50939] (2 families) (S)
  5. 674918Family b.68.1.1: Sialidases (neuraminidases) [50940] (9 proteins)
  6. 674931Protein Influenza neuraminidase [50943] (2 species)
  7. 674932Species Influenza A virus, different strains [TaxId:11320] [50944] (52 PDB entries)
  8. 674962Domain d1ivda_: 1ivd A: [27568]
    complexed with ca, fuc, man, nag, st1

Details for d1ivda_

PDB Entry: 1ivd (more details), 1.8 Å

PDB Description: structures of aromatic inhibitors of influenza virus neuraminidase
PDB Compounds: (A:) influenza a subtype n2 neuraminidase

SCOP Domain Sequences for d1ivda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ivda_ b.68.1.1 (A:) Influenza neuraminidase {Influenza A virus, different strains [TaxId: 11320]}
veyrnwskpqcqitgfapfskdnsirlsaggdiwvtrepyvscdpvkcyqfalgqgttld
nkhsndtvhdriphrtllmnelgvpfhlgtrqvciawsssschdgkawlhvcitgddkna
tasfiydgrlvdsigswsqnilrtqesecvcingtctvvmtdgsasgradtrilfieegk
ivhisplagsaqhveecscyprypgvrcicrdnwkgsnrpvvdinmedysidssyvcsgl
vgdtprnddrssnsncrdpnnergtqgvkgwafdngndlwmgrtiskdlrsgyetfkvig
gwstpnsksqinrqvivdsdnrsgysgifsvegkscinrcfyvelirgrkqetrvwwtsn
sivvfcgtsgtygtgswpdganinfmpi

SCOP Domain Coordinates for d1ivda_:

Click to download the PDB-style file with coordinates for d1ivda_.
(The format of our PDB-style files is described here.)

Timeline for d1ivda_: