Lineage for d5cp3a1 (5cp3 A:1-112)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1767332Species Mus musculus [TaxId:10090] [272437] (43 PDB entries)
  8. 1767344Domain d5cp3a1: 5cp3 A:1-112 [275614]
    Other proteins in same PDB: d5cp3a2
    automated match to d2g2ra1
    complexed with ca, gol, ytz

Details for d5cp3a1

PDB Entry: 5cp3 (more details), 1.99 Å

PDB Description: crystal structure of an antigen-binding fragment of monoclonal antibody against sulfonamides in complex with sulfathiazole
PDB Compounds: (A:) Light Chain of Antigen-Binding Fragment of Monoclonal Antibody of 4C7

SCOPe Domain Sequences for d5cp3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5cp3a1 b.1.1.0 (A:1-112) automated matches {Mus musculus [TaxId: 10090]}
dvvmtqtpitlsvtigqpasisckssqslldsdgktylnwllqrpgqspkrliylvskld
srvpdrftgsgagtdftlkisrveaedlgiyycwqgthfpqtfgggtkleik

SCOPe Domain Coordinates for d5cp3a1:

Click to download the PDB-style file with coordinates for d5cp3a1.
(The format of our PDB-style files is described here.)

Timeline for d5cp3a1: