SCOPe 2.05: Domain d5cp7e2: 5cp7 E:113-218

Lineage for d5cp7e2 (5cp7 E:113-218)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (14 species)
   not a true protein

7. Species Mus musculus [TaxId:10090] [272441] (35 PDB entries)

8. Domain d5cp7e2: 5cp7 E:113-218 [275611]
   Other proteins in same PDB: d5cp7a1, d5cp7c1, d5cp7e1, d5cp7g1
   automated match to d3mbxl2

Details for d5cp7e2

PDB Entry: 5cp7, 3.01 Å

PDB Description: crystal structure of an antigen-binding fragment of monoclonal antibody against sulfonamides

PDB Compounds: (E:) Light Chain of Antigen-Binding Fragment of Monoclonal Antibody of 4C7

SCOPe Domain Sequences for d5cp7e2:

Sequence; same for both SEQRES and ATOM records:

>d5cp7e2 b.1.1.2 (E:113-218) automated matches {Mus musculus [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnsetdqd
skdstysmsstltltkdeyerhntytceathktstspivksfnrne

Timeline for d5cp7e2:

• d5cp7e2 is new in SCOPe 2.05-stable
  
• d5cp7e2 appears in SCOPe 2.06
  
• d5cp7e2 appears in the current release, SCOPe 2.07