SCOPe 2.05: Domain d5cp7c1: 5cp7 C:1-112

Lineage for d5cp7c1 (5cp7 C:1-112)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Mus musculus [TaxId:10090] [272437] (43 PDB entries)

8. Domain d5cp7c1: 5cp7 C:1-112 [275605]
   Other proteins in same PDB: d5cp7a2, d5cp7c2, d5cp7e2, d5cp7g2
   automated match to d2g2ra1

Details for d5cp7c1

PDB Entry: 5cp7, 3.01 Å

PDB Description: crystal structure of an antigen-binding fragment of monoclonal antibody against sulfonamides

PDB Compounds: (C:) Light Chain of Antigen-Binding Fragment of Monoclonal Antibody of 4C7

SCOPe Domain Sequences for d5cp7c1:

Sequence; same for both SEQRES and ATOM records:

>d5cp7c1 b.1.1.0 (C:1-112) automated matches {Mus musculus [TaxId: 10090]}
dvvmtqtpitlsvtigqpasisckssqslldsdgktylnwllqrpgqspkrliylvskld
srvpdrftgsgagtdftlkisrveaedlgiyycwqgthfpqtfgggtkleik

Timeline for d5cp7c1:

• d5cp7c1 is new in SCOPe 2.05-stable
  
• d5cp7c1 appears in SCOPe 2.06
  
• d5cp7c1 appears in the current release, SCOPe 2.08