Lineage for d5c1mb_ (5c1m B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1755448Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1757949Protein automated matches [190119] (18 species)
    not a true protein
  7. 1758317Species Llama (Lama glama) [TaxId:9844] [187485] (93 PDB entries)
  8. 1758454Domain d5c1mb_: 5c1m B: [275587]
    automated match to d4jvpa_
    complexed with 4vo, clr, olc, p6g, po4

Details for d5c1mb_

PDB Entry: 5c1m (more details), 2.1 Å

PDB Description: crystal structure of active mu-opioid receptor bound to the agonist bu72
PDB Compounds: (B:) Nanobody 39

SCOPe Domain Sequences for d5c1mb_:

Sequence, based on SEQRES records: (download)

>d5c1mb_ b.1.1.1 (B:) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvqlvesggglvrpggslrlscvdsertsypmgwfrrapgkerefvasitwsgidptyad
svadrfttsrdvanntlylqmnslkhedtavyycaarapvgqssspydydywgqgtqvtv
ssaaa

Sequence, based on observed residues (ATOM records): (download)

>d5c1mb_ b.1.1.1 (B:) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvqlvesggglvrpggslrlscvdsertsypmgwfrrapgkerefvasitwsgidptyad
svadrfttsrdvanntlylqmnslkhedtavyycaarapvdydywgqgtqvtvssaaa

SCOPe Domain Coordinates for d5c1mb_:

Click to download the PDB-style file with coordinates for d5c1mb_.
(The format of our PDB-style files is described here.)

Timeline for d5c1mb_: