SCOPe 2.06: Domain d5c2tf2: 5c2t F:139-282

Lineage for d5c2tf2 (5c2t F:139-282)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families)
   contains two Fe4-S4 clusters

5. Family a.1.2.0: automated matches [230426] (1 protein)
   not a true family

6. Protein automated matches [230427] (1 species)
   not a true protein

7. Species Pig roundworm (Ascaris suum) [TaxId:6253] [256142] (8 PDB entries)

8. Domain d5c2tf2: 5c2t F:139-282 [275583]
   Other proteins in same PDB: d5c2tb1, d5c2tf1
   automated match to d3vrbb2
   complexed with 4yp, eph, f3s, fad, fes, hem, mli, sf4

Details for d5c2tf2

PDB Entry: 5c2t, 2.75 Å

PDB Description: crystal structure of mitochondrial rhodoquinol-fumarate reductase from ascaris suum with rhodoquinone-2

PDB Compounds: (F:) Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial

SCOPe Domain Sequences for d5c2tf2:

Sequence; same for both SEQRES and ATOM records:

>d5c2tf2 a.1.2.0 (F:139-282) automated matches {Pig roundworm (Ascaris suum) [TaxId: 6253]}
mnlfyaqyasiqpwlqkktkinlgekqqyqsikeqekldglyecilcaccsascpsywwn
adkylgpavlmqayrwiidsrddsaaerlarmqdgfsafkchtimnctktcpkhlnpara
igeikmlltkmktkpaplptpanf

Timeline for d5c2tf2:

• d5c2tf2 first appeared in SCOPe 2.05
  
• d5c2tf2 appears in SCOPe 2.07
  
• d5c2tf2 appears in the current release, SCOPe 2.08