Lineage for d5a9ga2 (5a9g A:86-202)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1903583Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 1903584Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 1903858Family d.44.1.0: automated matches [227155] (1 protein)
    not a true family
  6. 1903859Protein automated matches [226860] (30 species)
    not a true protein
  7. 1903995Species Sphingobacterium spiritivorum [TaxId:258] [275548] (1 PDB entry)
  8. 1903996Domain d5a9ga2: 5a9g A:86-202 [275551]
    Other proteins in same PDB: d5a9ga1, d5a9gb1
    automated match to d4k2wa2
    complexed with mn

Details for d5a9ga2

PDB Entry: 5a9g (more details), 1.35 Å

PDB Description: manganese superoxide dismutase from sphingobacterium sp. t2
PDB Compounds: (A:) manganese superoxide dismutase

SCOPe Domain Sequences for d5a9ga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5a9ga2 d.44.1.0 (A:86-202) automated matches {Sphingobacterium spiritivorum [TaxId: 258]}
nkgtkpsaalqkaidetfgsldalkekinaagaarfgsgwawlivdnggklqvtstpnqd
nplmdftkekgtpilgidvwehayylryqnkradylttiwdvinweevsaryekalk

SCOPe Domain Coordinates for d5a9ga2:

Click to download the PDB-style file with coordinates for d5a9ga2.
(The format of our PDB-style files is described here.)

Timeline for d5a9ga2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5a9ga1