SCOPe 2.06: Domain d5a9ga1: 5a9g A:1-85

Lineage for d5a9ga1 (5a9g A:1-85)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families)
   automatically mapped to Pfam PF00081

5. Family a.2.11.0: automated matches [227154] (1 protein)
   not a true family

6. Protein automated matches [226859] (32 species)
   not a true protein

7. Species Sphingobacterium spiritivorum [TaxId:258] [275545] (1 PDB entry)

8. Domain d5a9ga1: 5a9g A:1-85 [275547]
   Other proteins in same PDB: d5a9ga2, d5a9ga3, d5a9gb2, d5a9gb3
   automated match to d4k2wa1
   complexed with mn

Details for d5a9ga1

PDB Entry: 5a9g, 1.35 Å

PDB Description: manganese superoxide dismutase from sphingobacterium sp. t2

PDB Compounds: (A:) manganese superoxide dismutase

SCOPe Domain Sequences for d5a9ga1:

Sequence; same for both SEQRES and ATOM records:

>d5a9ga1 a.2.11.0 (A:1-85) automated matches {Sphingobacterium spiritivorum [TaxId: 258]}
qfkqtplpyaydalegaidaktmeihyskhaagytanlnkaiagtpaekesienilakvs
qysdavrnnagghynhelfwsiltp

Timeline for d5a9ga1:

• d5a9ga1 first appeared in SCOPe 2.05
  
• d5a9ga1 appears in SCOPe 2.07
  
• d5a9ga1 appears in the current release, SCOPe 2.08