Class a: All alpha proteins [46456] (286 folds) |
Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) automatically mapped to Pfam PF00081 |
Family a.2.11.0: automated matches [227154] (1 protein) not a true family |
Protein automated matches [226859] (31 species) not a true protein |
Species Sphingobacterium spiritivorum [TaxId:258] [275545] (1 PDB entry) |
Domain d5a9ga1: 5a9g A:-3-85 [275547] Other proteins in same PDB: d5a9ga2, d5a9gb2 automated match to d4k2wa1 complexed with mn |
PDB Entry: 5a9g (more details), 1.35 Å
SCOPe Domain Sequences for d5a9ga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5a9ga1 a.2.11.0 (A:-3-85) automated matches {Sphingobacterium spiritivorum [TaxId: 258]} dpftqfkqtplpyaydalegaidaktmeihyskhaagytanlnkaiagtpaekesienil akvsqysdavrnnagghynhelfwsiltp
Timeline for d5a9ga1: