Lineage for d5a4cb1 (5a4c B:461-765)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2543630Protein Fibroblast growth factor receptor 1 [56158] (1 species)
    PTK group; FGFR subfamily; membrane spanning protein tyrosine kinase
  7. 2543631Species Human (Homo sapiens) [TaxId:9606] [56159] (46 PDB entries)
  8. 2543669Domain d5a4cb1: 5a4c B:461-765 [275542]
    Other proteins in same PDB: d5a4cb2
    automated match to d4v04b_
    complexed with edo, so4, xoj

Details for d5a4cb1

PDB Entry: 5a4c (more details), 2.09 Å

PDB Description: fgfr1 ligand complex
PDB Compounds: (B:) fibroblast growth factor receptor 1 (fms-related tyrosine kinase 2, pfeiffer syndrome), isoform cra_b

SCOPe Domain Sequences for d5a4cb1:

Sequence, based on SEQRES records: (download)

>d5a4cb1 d.144.1.7 (B:461-765) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]}
seyelpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavkmlksda
tekdlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrppg
leysynpshnpeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvtednvmkia
dfglardihhidyykkttngrlpvkwmapealfdriythqsdvwsfgvllweiftlggsp
ypgvpveelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedldrival
tsnqe

Sequence, based on observed residues (ATOM records): (download)

>d5a4cb1 d.144.1.7 (B:461-765) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]}
seyelpedprwelprdrlvlgkplgegafgqvvlaeaigldpnrvtkvavkmlksdatek
dlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrppeqls
skdlvscayqvargmeylaskkcihrdlaarnvlvtednvmkiadfglaidyykkttngr
lpvkwmapealfdriythqsdvwsfgvllweiftlggspypgvpveelfkllkeghrmdk
psnctnelymmmrdcwhavpsqrptfkqlvedldrivaltsnqe

SCOPe Domain Coordinates for d5a4cb1:

Click to download the PDB-style file with coordinates for d5a4cb1.
(The format of our PDB-style files is described here.)

Timeline for d5a4cb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5a4cb2
View in 3D
Domains from other chains:
(mouse over for more information)
d5a4ca_