Class b: All beta proteins [48724] (180 folds) |
Fold b.74: Carbonic anhydrase [51068] (1 superfamily) single sheet; 10 strands |
Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) |
Family b.74.1.0: automated matches [191576] (1 protein) not a true family |
Protein automated matches [191011] (16 species) not a true protein |
Species Thiomicrospira crunogena [TaxId:317025] [275505] (1 PDB entry) |
Domain d4xz5b_: 4xz5 B: [275506] automated match to d3iaib_ complexed with bct, zn |
PDB Entry: 4xz5 (more details), 2.6 Å
SCOPe Domain Sequences for d4xz5b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xz5b_ b.74.1.0 (B:) automated matches {Thiomicrospira crunogena [TaxId: 317025]} pphwgyfgeegpqywgelapefstcktgknqspinlkpqtavgttslpgfdvyyretalk linnghtlqvniplgsyikinghryellqyhfhtpsehqrdgfnypmemhlvhkdgdgnl aviailfqegeenetlaklmsflpqtlkkqeihesvkihpakffpadkkfykysgslttp pcsegvywmvfkqpiqasvtqlekmheylgsnarpvqrqnartllkswpd
Timeline for d4xz5b_: