Lineage for d4tzea1 (4tze A:42-270)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2996664Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2996665Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) (S)
  5. 2997604Family d.157.1.0: automated matches [191360] (1 protein)
    not a true family
  6. 2997605Protein automated matches [190418] (31 species)
    not a true protein
  7. 2997639Species Escherichia coli [TaxId:562] [226145] (21 PDB entries)
  8. 2997650Domain d4tzea1: 4tze A:42-270 [275431]
    Other proteins in same PDB: d4tzea2
    automated match to d3zr9a_
    complexed with zn

Details for d4tzea1

PDB Entry: 4tze (more details), 1.57 Å

PDB Description: structure of metallo-beta-lactamase
PDB Compounds: (A:) Class B carbapenemase NDM-5

SCOPe Domain Sequences for d4tzea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4tzea1 d.157.1.0 (A:42-270) automated matches {Escherichia coli [TaxId: 562]}
gdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvllvdtawtddqtaqi
lnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqeglvaaqhsl
tfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikdskakslgnl
gdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadklr

SCOPe Domain Coordinates for d4tzea1:

Click to download the PDB-style file with coordinates for d4tzea1.
(The format of our PDB-style files is described here.)

Timeline for d4tzea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4tzea2
View in 3D
Domains from other chains:
(mouse over for more information)
d4tzeb_