Lineage for d4rd6a2 (4rd6 A:207-320)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2062589Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2062651Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 2062960Family b.43.3.0: automated matches [227211] (1 protein)
    not a true family
  6. 2062961Protein automated matches [226946] (26 species)
    not a true protein
  7. 2063067Species Sulfolobus solfataricus [TaxId:273057] [256084] (12 PDB entries)
  8. 2063077Domain d4rd6a2: 4rd6 A:207-320 [275423]
    Other proteins in same PDB: d4rd6a1, d4rd6a3
    automated match to d4m53a2
    complexed with gdp, mg

Details for d4rd6a2

PDB Entry: 4rd6 (more details), 1.94 Å

PDB Description: structure of aif2-gamma from sulfolobus solfataricus bound to gdp
PDB Compounds: (A:) Translation initiation factor 2 subunit gamma

SCOPe Domain Sequences for d4rd6a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rd6a2 b.43.3.0 (A:207-320) automated matches {Sulfolobus solfataricus [TaxId: 273057]}
rdlsqkpvmlvirsfdvnkpgtqfnelkggviggsiiqglfkvdqeikvlpglrvekqgk
vsyepiftkissirfgdeefkeakpgglvaigtyldpsltkadnllgsiitlad

SCOPe Domain Coordinates for d4rd6a2:

Click to download the PDB-style file with coordinates for d4rd6a2.
(The format of our PDB-style files is described here.)

Timeline for d4rd6a2: