Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (14 species) not a true protein |
Species Homo sapiens [TaxId:9606] [268989] (70 PDB entries) |
Domain d4r7dh2: 4r7d H:107-212 [275415] Other proteins in same PDB: d4r7db1, d4r7dd1, d4r7df1, d4r7dh1, d4r7dj1, d4r7dl1, d4r7dn1, d4r7dp1 automated match to d1dn0a2 |
PDB Entry: 4r7d (more details), 2.75 Å
SCOPe Domain Sequences for d4r7dh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4r7dh2 b.1.1.2 (H:107-212) automated matches {Homo sapiens [TaxId: 9606]} krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg
Timeline for d4r7dh2: