Lineage for d4r1nd2 (4r1n D:184-282)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006475Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 2006476Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 2006685Family a.100.1.0: automated matches [227147] (1 protein)
    not a true family
  6. 2006686Protein automated matches [226851] (35 species)
    not a true protein
  7. 2006701Species Clostridium butyricum [TaxId:632245] [256902] (4 PDB entries)
  8. 2006709Domain d4r1nd2: 4r1n D:184-282 [275399]
    Other proteins in same PDB: d4r1na1, d4r1nb1, d4r1nc1, d4r1nd1
    automated match to d4kuga2

Details for d4r1nd2

PDB Entry: 4r1n (more details), 1.8 Å

PDB Description: crystal structure of (s)-3-hydroxybutylryl-coa dehydrogenase form the n-butanol sysnthesizing bacterium, clostridium butyricum.
PDB Compounds: (D:) 3-hydroxybutyryl-CoA dehydrogenase

SCOPe Domain Sequences for d4r1nd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4r1nd2 a.100.1.0 (D:184-282) automated matches {Clostridium butyricum [TaxId: 632245]}
gfvvnrilipmineatfilqegvakeedidaamklganhpmgplalgdligldvclaimd
vlynetgdtkyrassllrkyvragwlgrktgkgfydysk

SCOPe Domain Coordinates for d4r1nd2:

Click to download the PDB-style file with coordinates for d4r1nd2.
(The format of our PDB-style files is described here.)

Timeline for d4r1nd2: