Class a: All alpha proteins [46456] (289 folds) |
Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
Family a.100.1.0: automated matches [227147] (1 protein) not a true family |
Protein automated matches [226851] (35 species) not a true protein |
Species Clostridium butyricum [TaxId:632245] [256902] (4 PDB entries) |
Domain d4r1nd2: 4r1n D:184-282 [275399] Other proteins in same PDB: d4r1na1, d4r1nb1, d4r1nc1, d4r1nd1 automated match to d4kuga2 |
PDB Entry: 4r1n (more details), 1.8 Å
SCOPe Domain Sequences for d4r1nd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4r1nd2 a.100.1.0 (D:184-282) automated matches {Clostridium butyricum [TaxId: 632245]} gfvvnrilipmineatfilqegvakeedidaamklganhpmgplalgdligldvclaimd vlynetgdtkyrassllrkyvragwlgrktgkgfydysk
Timeline for d4r1nd2: