Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (239 species) not a true protein |
Species Clostridium butyricum [TaxId:632245] [256900] (4 PDB entries) |
Domain d4r1nb1: 4r1n B:1-183 [275394] Other proteins in same PDB: d4r1na2, d4r1nb2, d4r1nc2, d4r1nd2 automated match to d4kuea1 |
PDB Entry: 4r1n (more details), 1.8 Å
SCOPe Domain Sequences for d4r1nb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4r1nb1 c.2.1.0 (B:1-183) automated matches {Clostridium butyricum [TaxId: 632245]} mkkvfvlgagtmgagivqafaakgcevivrdikeefvdrgiatitkslsklvakekitea dkeeilsrisgttdmklaadcdlvveaaienmkikkeifaeldgickpetilasntssls itevasatkradkvigmhffnpapvmklvevirgaatsqetfdavkemsesigktpveva eap
Timeline for d4r1nb1: