Lineage for d4zu2b_ (4zu2 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2852293Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2852294Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2853595Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2853596Protein automated matches [190246] (71 species)
    not a true protein
  7. 2854189Species Pseudomonas aeruginosa [TaxId:287] [275309] (3 PDB entries)
  8. 2854212Domain d4zu2b_: 4zu2 B: [275310]
    automated match to d4k3wb_
    complexed with iod

Details for d4zu2b_

PDB Entry: 4zu2 (more details), 2.15 Å

PDB Description: pseudomonas aeruginosa atue
PDB Compounds: (B:) Putative isohexenylglutaconyl-CoA hydratase

SCOPe Domain Sequences for d4zu2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zu2b_ c.14.1.0 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
etlllepiegvlritlnrpqsrnamslamvgelravlaavrddrsvralvlrgadghfca
ggdikdmagaraagaeayrtlnrafgslleeaqaapqllvalvegavlgggfglacvsdv
aiaaadaqfglpetslgilpaqiapfvvrrigltqarrlaltaarfdgrealrlglvhfc
eadadaleqrleetleqlrrcapnanaatkalllasesgelgallddaarqfaeavggae
gsegtlafvqkrkpvwaq

SCOPe Domain Coordinates for d4zu2b_:

Click to download the PDB-style file with coordinates for d4zu2b_.
(The format of our PDB-style files is described here.)

Timeline for d4zu2b_: