Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.0: automated matches [191346] (1 protein) not a true family |
Protein automated matches [190246] (71 species) not a true protein |
Species Pseudomonas aeruginosa [TaxId:287] [275309] (3 PDB entries) |
Domain d4zu2b_: 4zu2 B: [275310] automated match to d4k3wb_ complexed with iod |
PDB Entry: 4zu2 (more details), 2.15 Å
SCOPe Domain Sequences for d4zu2b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4zu2b_ c.14.1.0 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 287]} etlllepiegvlritlnrpqsrnamslamvgelravlaavrddrsvralvlrgadghfca ggdikdmagaraagaeayrtlnrafgslleeaqaapqllvalvegavlgggfglacvsdv aiaaadaqfglpetslgilpaqiapfvvrrigltqarrlaltaarfdgrealrlglvhfc eadadaleqrleetleqlrrcapnanaatkalllasesgelgallddaarqfaeavggae gsegtlafvqkrkpvwaq
Timeline for d4zu2b_: