Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
Protein cAMP-dependent PK, catalytic subunit [56116] (7 species) AGC group; PKA subfamily; serine/threonine kinase |
Species Mouse (Mus musculus) [TaxId:10090] [56119] (33 PDB entries) |
Domain d4x6qc_: 4x6q C: [275302] automated match to d1l3re_ |
PDB Entry: 4x6q (more details), 2.52 Å
SCOPe Domain Sequences for d4x6qc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4x6qc_ d.144.1.7 (C:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} svkeflakakedflkkwetpsqntaqldqfdriktlgtgsfgrvmlvkhkesgnhyamki ldkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvmeyvaggemfshlr rigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyiqvtdfgfakrvkg rtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadqpiqiyekivsg kvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfattdwiaiyqrkveap fipkfkgpgdtsnfddyeeeeirvsinekcgkeftef
Timeline for d4x6qc_: