Lineage for d4wxvb_ (4wxv B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2794859Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2795997Protein Trypsin(ogen) [50515] (9 species)
  7. 2796569Species Human (Homo sapiens) [TaxId:9606] [50519] (4 PDB entries)
  8. 2796577Domain d4wxvb_: 4wxv B: [275299]
    Other proteins in same PDB: d4wxvc_, d4wxvi_
    automated match to d2ra3a_
    complexed with ca, so4; mutant

Details for d4wxvb_

PDB Entry: 4wxv (more details), 2.1 Å

PDB Description: human cationic trypsin k97d mutant in complex with bovine pancreatic trypsin inhibitor (bpti)
PDB Compounds: (B:) Trypsin-1

SCOPe Domain Sequences for d4wxvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wxvb_ b.47.1.2 (B:) Trypsin(ogen) {Human (Homo sapiens) [TaxId: 9606]}
ivggynceensvpyqvslnsgyhfcggslineqwvvsaghcyksriqvrlgehnievleg
neqfinaakiirhpqydrdtlnndimliklssravinahvstislptappatgtkclisg
wgntassgadypdelqcldapvlsqakceasypgkitsnmfcvgfleggkdscqgdaggp
vvcngqlqgvvswgdgcaqknkpgvytkvynyvkwikntiaans

SCOPe Domain Coordinates for d4wxvb_:

Click to download the PDB-style file with coordinates for d4wxvb_.
(The format of our PDB-style files is described here.)

Timeline for d4wxvb_: