Class a: All alpha proteins [46456] (290 folds) |
Fold a.6: Putative DNA-binding domain [46954] (1 superfamily) core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different |
Superfamily a.6.1: Putative DNA-binding domain [46955] (8 families) |
Family a.6.1.0: automated matches [191604] (1 protein) not a true family |
Protein automated matches [191102] (6 species) not a true protein |
Species Bacillus megaterium [TaxId:1404] [275234] (2 PDB entries) |
Domain d4ua2g_: 4ua2 G: [275243] automated match to d1q05b_ |
PDB Entry: 4ua2 (more details), 2.61 Å
SCOPe Domain Sequences for d4ua2g_:
Sequence, based on SEQRES records: (download)
>d4ua2g_ a.6.1.0 (G:) automated matches {Bacillus megaterium [TaxId: 1404]} ladkcgvnketiryyerlglipepertekgyrmysqqtvdrlhfikrmqelgftlneidk llgvvdrdeakcrdmydftilkiediqrkiedlkriermlmdlkercpenkdiyecpiie tlm
>d4ua2g_ a.6.1.0 (G:) automated matches {Bacillus megaterium [TaxId: 1404]} ladkcgvnketiryyerlglipepmysqqtvdrlhfikrmqelgftlneidkllgvvdrd eakcrdmydftilkiediqrkiedlkriermlmdlkercpenkdiyecpiietlm
Timeline for d4ua2g_: