Lineage for d4s2mb_ (4s2m B:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2568471Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2568472Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2569658Family e.3.1.0: automated matches [191512] (1 protein)
    not a true family
  6. 2569659Protein automated matches [190857] (55 species)
    not a true protein
  7. 2569799Species Enterobacter cloacae [TaxId:550] [271105] (6 PDB entries)
  8. 2569808Domain d4s2mb_: 4s2m B: [275225]
    automated match to d3hbra_
    complexed with iod

Details for d4s2mb_

PDB Entry: 4s2m (more details), 2.87 Å

PDB Description: crystal structure of oxa-163 complexed with iodide in the active site
PDB Compounds: (B:) Beta-lactamase

SCOPe Domain Sequences for d4s2mb_:

Sequence, based on SEQRES records: (download)

>d4s2mb_ e.3.1.0 (B:) automated matches {Enterobacter cloacae [TaxId: 550]}
wqenkswnahftehksqgvvvlwnenkqqgftnnlkranqaflpastfkipnslialdlg
vvkdehqvfkwdgqtrdiatwnrdhnlitamkysvvpvyqefarqigearmskmlhafdy
gnedisgnvdsfwldggirisateqisflrklyhnklhvsersqrivkqamlteangdyi
iraktgydtkigwwvgwvelddnvwffamnmdmptsdglglrqaitkevlkqekiip

Sequence, based on observed residues (ATOM records): (download)

>d4s2mb_ e.3.1.0 (B:) automated matches {Enterobacter cloacae [TaxId: 550]}
wqenkswnahftehksqgvvvlwnenkqqgftnnlkranqaflpastfkipnslialdlg
vvkdehqvfkwdgqtrdiatwnrdhnlitamkysvvpvyqefarqigearmskmlhafdy
gnedisgnvdsfwldggirisateqisflrklyhnklhvsersqrivkqamlteangdyi
iraktgydtkigwwvgwvelddnvwffamnmdmpglglrqaitkevlkqekiip

SCOPe Domain Coordinates for d4s2mb_:

Click to download the PDB-style file with coordinates for d4s2mb_.
(The format of our PDB-style files is described here.)

Timeline for d4s2mb_: