SCOPe 2.08: Domain d4r8hb2: 4r8h B:139-209

Lineage for d4r8hb2 (4r8h B:139-209)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (92 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [225713] (14 PDB entries)

8. Domain d4r8hb2: 4r8h B:139-209 [275221]
   Other proteins in same PDB: d4r8ha1, d4r8hb1
   automated match to d4i02a2
   complexed with gol, sp1

Details for d4r8hb2

PDB Entry: 4r8h, 1.46 Å

PDB Description: the role of protein-ligand contacts in allosteric regulation of the escherichia coli catabolite activator protein

PDB Compounds: (B:) cAMP-activated global transcriptional regulator CRP

SCOPe Domain Sequences for d4r8hb2:

Sequence; same for both SEQRES and ATOM records:

>d4r8hb2 a.4.5.0 (B:139-209) automated matches {Escherichia coli K-12 [TaxId: 83333]}
dvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsretvgrilkmledqnlis
ahgktivvygt

Timeline for d4r8hb2:

• d4r8hb2 first appeared in SCOPe 2.05
  
• d4r8hb2 appears in SCOPe 2.07