SCOPe 2.08: Domain d4r8hb1: 4r8h B:9-138

Lineage for d4r8hb1 (4r8h B:9-138)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families)

5. Family b.82.3.2: cAMP-binding domain [51210] (13 proteins)
   Pfam PF00027

6. Protein automated matches [190352] (10 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [225712] (8 PDB entries)

8. Domain d4r8hb1: 4r8h B:9-138 [275220]
   Other proteins in same PDB: d4r8ha2, d4r8hb2
   automated match to d4i02b1
   complexed with gol, sp1

Details for d4r8hb1

PDB Entry: 4r8h, 1.46 Å

PDB Description: the role of protein-ligand contacts in allosteric regulation of the escherichia coli catabolite activator protein

PDB Compounds: (B:) cAMP-activated global transcriptional regulator CRP

SCOPe Domain Sequences for d4r8hb1:

Sequence; same for both SEQRES and ATOM records:

>d4r8hb1 b.82.3.2 (B:9-138) automated matches {Escherichia coli K-12 [TaxId: 83333]}
dptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkemilsylnqg
dfigelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlsaqmarrlqvt
sekvgnlafl

Timeline for d4r8hb1:

• d4r8hb1 first appeared in SCOPe 2.05
  
• d4r8hb1 appears in SCOPe 2.07