Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) contains a small beta-sheet (wing) |
Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
Protein automated matches [190154] (92 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [225713] (14 PDB entries) |
Domain d4r8ha2: 4r8h A:139-208 [275219] Other proteins in same PDB: d4r8ha1, d4r8hb1 automated match to d4i02a2 complexed with gol, sp1 |
PDB Entry: 4r8h (more details), 1.46 Å
SCOPe Domain Sequences for d4r8ha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4r8ha2 a.4.5.0 (A:139-208) automated matches {Escherichia coli K-12 [TaxId: 83333]} dvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsretvgrilkmledqnlis ahgktivvyg
Timeline for d4r8ha2: