Class b: All beta proteins [48724] (180 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) |
Family b.82.3.2: cAMP-binding domain [51210] (13 proteins) Pfam PF00027 |
Protein automated matches [190352] (10 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [225712] (8 PDB entries) |
Domain d4r8ha1: 4r8h A:9-138 [275218] Other proteins in same PDB: d4r8ha2, d4r8hb2 automated match to d4i02b1 complexed with gol, sp1 |
PDB Entry: 4r8h (more details), 1.46 Å
SCOPe Domain Sequences for d4r8ha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4r8ha1 b.82.3.2 (A:9-138) automated matches {Escherichia coli K-12 [TaxId: 83333]} dptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkemilsylnqg dfigelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlsaqmarrlqvt sekvgnlafl
Timeline for d4r8ha1: