Class b: All beta proteins [48724] (180 folds) |
Fold b.38: Sm-like fold [50181] (5 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology |
Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) |
Family b.38.1.0: automated matches [191538] (1 protein) not a true family |
Protein automated matches [190914] (14 species) not a true protein |
Species Klebsiella pneumoniae [TaxId:272620] [275179] (1 PDB entry) |
Domain d5caie_: 5cai E: [275181] automated match to d2rd1b_ complexed with cl |
PDB Entry: 5cai (more details), 2.3 Å
SCOPe Domain Sequences for d5caie_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5caie_ b.38.1.0 (E:) automated matches {Klebsiella pneumoniae [TaxId: 272620]} snyvmhtndgrtivtdgkpqtdndtgmisykdawgnkqqinrsdvkqlgeld
Timeline for d5caie_: