Lineage for d5caie_ (5cai E:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2786770Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 2786771Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 2787428Family b.38.1.0: automated matches [191538] (1 protein)
    not a true family
  6. 2787429Protein automated matches [190914] (14 species)
    not a true protein
  7. 2787605Species Klebsiella pneumoniae [TaxId:272620] [275179] (1 PDB entry)
  8. 2787610Domain d5caie_: 5cai E: [275181]
    automated match to d2rd1b_
    complexed with cl

Details for d5caie_

PDB Entry: 5cai (more details), 2.3 Å

PDB Description: crystal structure of a putative lipoprotein from the duf903 family (kpn_03160) from klebsiella pneumoniae subsp. pneumoniae mgh 78578 at 2.30 a resolution
PDB Compounds: (E:) Putative lipoprotein from the DUF903 family

SCOPe Domain Sequences for d5caie_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5caie_ b.38.1.0 (E:) automated matches {Klebsiella pneumoniae [TaxId: 272620]}
snyvmhtndgrtivtdgkpqtdndtgmisykdawgnkqqinrsdvkqlgeld

SCOPe Domain Coordinates for d5caie_:

Click to download the PDB-style file with coordinates for d5caie_.
(The format of our PDB-style files is described here.)

Timeline for d5caie_: