Lineage for d5brlb_ (5brl B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2214642Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2214908Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 2215232Family d.129.3.0: automated matches [191339] (1 protein)
    not a true family
  6. 2215233Protein automated matches [190218] (22 species)
    not a true protein
  7. 2215385Species Mouse (Mus musculus) [TaxId:10090] [275171] (1 PDB entry)
  8. 2215387Domain d5brlb_: 5brl B: [275174]
    automated match to d2r55a_

Details for d5brlb_

PDB Entry: 5brl (more details), 2 Å

PDB Description: crystal structure of l124d stard4
PDB Compounds: (B:) StAR-related lipid transfer protein 4

SCOPe Domain Sequences for d5brlb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5brlb_ d.129.3.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rkikleglsdvasistklqntliqyhsikedewrvakkvkdvtvwrkpseefngylykaq
gvmddvvnnvidhirpgpwrldwdrlmtsldvlehfeenccvmryttagqldniispref
vdfsytvgyeegllscgvsvewsetrpefvrgynhpcgwfcvplkdspsqslltgyiqtd
lrgmipqsavdtamastlanfysdlrkglr

SCOPe Domain Coordinates for d5brlb_:

Click to download the PDB-style file with coordinates for d5brlb_.
(The format of our PDB-style files is described here.)

Timeline for d5brlb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5brla_