Lineage for d5brla_ (5brl A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1926121Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 1926373Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 1926677Family d.129.3.0: automated matches [191339] (1 protein)
    not a true family
  6. 1926678Protein automated matches [190218] (20 species)
    not a true protein
  7. 1926789Species Mus musculus [TaxId:10090] [275171] (1 PDB entry)
  8. 1926790Domain d5brla_: 5brl A: [275173]
    automated match to d2r55a_

Details for d5brla_

PDB Entry: 5brl (more details), 2 Å

PDB Description: crystal structure of l124d stard4
PDB Compounds: (A:) StAR-related lipid transfer protein 4

SCOPe Domain Sequences for d5brla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5brla_ d.129.3.0 (A:) automated matches {Mus musculus [TaxId: 10090]}
rkikleglsdvasistklqntliqyhsikedewrvakkvkdvtvwrkpseefngylykaq
gvmddvvnnvidhirpgpwrldwdrlmtsldvlehfeenccvmryttagqldniispref
vdfsytvgyeegllscgvsvewsetrpefvrgynhpcgwfcvplkdspsqslltgyiqtd
lrgmipqsavdtamastlanfysdlrkglr

SCOPe Domain Coordinates for d5brla_:

Click to download the PDB-style file with coordinates for d5brla_.
(The format of our PDB-style files is described here.)

Timeline for d5brla_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5brlb_