SCOPe 2.07: Domain d5a5oa1: 5a5o A:981-1108

Lineage for d5a5oa1 (5a5o A:981-1108)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187641] (1004 PDB entries)

8. Domain d5a5oa1: 5a5o A:981-1108 [275163]
   Other proteins in same PDB: d5a5oa2
   automated match to d4tz2a_
   complexed with edo, j5i, so4

Details for d5a5oa1

PDB Entry: 5a5o, 2.04 Å

PDB Description: crystal structure of human atad2 bromodomain in complex with 3-methyl-1,2-dihydroquinolin-2-one

PDB Compounds: (A:) ATPase family AAA domain-containing protein 2

SCOPe Domain Sequences for d5a5oa1:

Sequence; same for both SEQRES and ATOM records:

>d5a5oa1 a.29.2.0 (A:981-1108) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qeedtfrelriflrnvthrlaidkrfrvftkpvdpdevpdyvtvikqpmdlssviskidl
hkyltvkdylrdidlicsnaleynpdrdpgdrlirhracalrdtayaiikeeldedfeql
ceeiqesr

Timeline for d5a5oa1:

• d5a5oa1 first appeared in SCOPe 2.05, called d5a5oa_
  
• d5a5oa1 appears in SCOPe 2.06
  
• d5a5oa1 appears in the current release, SCOPe 2.08