SCOPe 2.08: Domain d4zu7e1: 4zu7 E:2-136

Lineage for d4zu7e1 (4zu7 E:2-136)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.0: automated matches [191354] (1 protein)
   not a true family

6. Protein automated matches [190388] (30 species)
   not a true protein

7. Species Thermoanaerobacterium thermosaccharolyticum [TaxId:1517] [238466] (4 PDB entries)

8. Domain d4zu7e1: 4zu7 E:2-136 [275145]
   Other proteins in same PDB: d4zu7a2, d4zu7b2, d4zu7c2, d4zu7d2, d4zu7e2, d4zu7f2
   automated match to d4o9ga_
   complexed with pxn, tyd; mutant

Details for d4zu7e1

PDB Entry: 4zu7, 2.3 Å

PDB Description: x-ray structure if the qdta 3,4-ketoisomerase from thermoanaerobacterium thermosaccharolyticum, double mutant y17r/r97h, in complex with tdp

PDB Compounds: (E:) QdtA

SCOPe Domain Sequences for d4zu7e1:

Sequence; same for both SEQRES and ATOM records:

>d4zu7e1 b.82.1.0 (E:2-136) automated matches {Thermoanaerobacterium thermosaccharolyticum [TaxId: 1517]}
lynvalikfkdiadkrghltpiegkidipfdikrvyyitkvdkditrgyhshkklhqvli
clngsvkirlkipdeekiielndpsvglyigplvwhemfdftegcvllvlaseyydetdy
irnydfyideakkrf

Timeline for d4zu7e1:

• d4zu7e1 first appeared in SCOPe 2.05, called d4zu7e_
  
• d4zu7e1 appears in SCOPe 2.07