SCOPe 2.08: Domain d4z28b_: 4z28 B:

Lineage for d4z28b_ (4z28 B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.0: automated matches [191402] (1 protein)
   not a true family

6. Protein automated matches [190537] (10 species)
   not a true protein

7. Species Hoeflea phototrophica [TaxId:411684] [275106] (7 PDB entries)

8. Domain d4z28b_: 4z28 B: [275112]
   automated match to d3t2xa_
   complexed with btb, btn

Details for d4z28b_

PDB Entry: 4z28, 1.66 Å

PDB Description: crystal structure of short hoefavidin biotin complex

PDB Compounds: (B:) Avidin family

SCOPe Domain Sequences for d4z28b_:

Sequence; same for both SEQRES and ATOM records:

>d4z28b_ b.61.1.0 (B:) automated matches {Hoeflea phototrophica [TaxId: 411684]}
pdmkllagasnwvnqsgsvaqfvftpsptqpqtyevsgnyinnaqgtgckgtpyplsgay
ysgnqiisfsvvwsnasancqsatgwtgyfdfsgsqavlktdwnlafysgstpaiqqgqd
dfmqsv

Timeline for d4z28b_:

• d4z28b_ first appeared in SCOPe 2.05
  
• d4z28b_ appears in SCOPe 2.07