SCOPe 2.08: Domain d4z2va_: 4z2v A:

Lineage for d4z2va_ (4z2v A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.0: automated matches [191402] (1 protein)
   not a true family

6. Protein automated matches [190537] (10 species)
   not a true protein

7. Species Hoeflea phototrophica [TaxId:411684] [275106] (7 PDB entries)

8. Domain d4z2va_: 4z2v A: [275108]
   automated match to d3t2xa_

Details for d4z2va_

PDB Entry: 4z2v, 1.39 Å

PDB Description: crystal structure of short hoefavidin-hoef-peptide complex

PDB Compounds: (A:) Avidin family

SCOPe Domain Sequences for d4z2va_:

Sequence; same for both SEQRES and ATOM records:

>d4z2va_ b.61.1.0 (A:) automated matches {Hoeflea phototrophica [TaxId: 411684]}
spdmkllagasnwvnqsgsvaqfvftpsptqpqtyevsgnyinnaqgtgckgtpyplsga
yysgnqiisfsvvwsnasancqsatgwtgyfdfsgsqavlktdwnlafysgstpaiqqgq
ddfmqsv

Timeline for d4z2va_:

• d4z2va_ first appeared in SCOPe 2.05
  
• d4z2va_ appears in SCOPe 2.07