Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) |
Family c.1.1.0: automated matches [191424] (1 protein) not a true family |
Protein automated matches [190605] (25 species) not a true protein |
Species Streptomyces coelicolor [TaxId:100226] [275080] (1 PDB entry) |
Domain d4y9ac_: 4y9a C: [275083] automated match to d2y6za_ |
PDB Entry: 4y9a (more details), 2.29 Å
SCOPe Domain Sequences for d4y9ac_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4y9ac_ c.1.1.0 (C:) automated matches {Streptomyces coelicolor [TaxId: 100226]} rtplmagnwkmnlnhleaiahvqklafaladkdydavevavlapftdlrsvqtlvdgdkl kikygaqdisahdggaytgeisgpmlaklkctyvavghserrqyhaetdeivnakvkaay khgltpilcvgeeldvreagnhvehtlaqvegglkdlaaeqaesvviayepvwaigtgkv cgaddaqevcaairgklaelysqeladkvriqyggsvksgnvaeimakpdidgalvggas ldsdefvkivrfrd
Timeline for d4y9ac_: