Lineage for d4y9ad_ (4y9a D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2826026Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 2826483Family c.1.1.0: automated matches [191424] (1 protein)
    not a true family
  6. 2826484Protein automated matches [190605] (25 species)
    not a true protein
  7. 2826595Species Streptomyces coelicolor [TaxId:100226] [275080] (1 PDB entry)
  8. 2826599Domain d4y9ad_: 4y9a D: [275082]
    automated match to d2y6za_

Details for d4y9ad_

PDB Entry: 4y9a (more details), 2.29 Å

PDB Description: crystal structure of triosephosphate isomerase from streptomyces coelicolor
PDB Compounds: (D:) triosephosphate isomerase

SCOPe Domain Sequences for d4y9ad_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4y9ad_ c.1.1.0 (D:) automated matches {Streptomyces coelicolor [TaxId: 100226]}
trtplmagnwkmnlnhleaiahvqklafaladkdydavevavlapftdlrsvqtlvdgdk
lkikygaqdisahdggaytgeisgpmlaklkctyvavghserrqyhaetdeivnakvkaa
ykhgltpilcvgeeldvreagnhvehtlaqvegglkdlaaeqaesvviayepvwaigtgk
vcgaddaqevcaairgklaelysqeladkvriqyggsvksgnvaeimakpdidgalvgga
sldsdefvkivrfrd

SCOPe Domain Coordinates for d4y9ad_:

Click to download the PDB-style file with coordinates for d4y9ad_.
(The format of our PDB-style files is described here.)

Timeline for d4y9ad_: