SCOPe 2.05: Domain d4xnqa2: 4xnq A:107-208

Lineage for d4xnqa2 (4xnq A:107-208)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (14 species)
   not a true protein

7. Species Homo sapiens [TaxId:9606] [268989] (70 PDB entries)

8. Domain d4xnqa2: 4xnq A:107-208 [275067]
   Other proteins in same PDB: d4xnqa1, d4xnql1
   automated match to d2dd8l2

Details for d4xnqa2

PDB Entry: 4xnq, 2 Å

PDB Description: antibody hemagglutinin complexes

PDB Compounds: (A:) H5.3 Light chain

SCOPe Domain Sequences for d4xnqa2:

Sequence; same for both SEQRES and ATOM records:

>d4xnqa2 b.1.1.2 (A:107-208) automated matches {Homo sapiens [TaxId: 9606]}
qpkanptvtlfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvapt

Timeline for d4xnqa2:

• d4xnqa2 is new in SCOPe 2.05-stable
  
• d4xnqa2 appears in SCOPe 2.06
  
• d4xnqa2 appears in the current release, SCOPe 2.08