Lineage for d4xoic_ (4xoi C:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1845934Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1846955Protein automated matches [190047] (27 species)
    not a true protein
  7. 1847028Species Human (Homo sapiens) [TaxId:9606] [186768] (145 PDB entries)
  8. 1847216Domain d4xoic_: 4xoi C: [275060]
    automated match to d4f38a_
    complexed with gtp, mg

Details for d4xoic_

PDB Entry: 4xoi (more details), 2.09 Å

PDB Description: structure of hsanillin bound with rhoa(q63l) at 2.1 angstroms resolution
PDB Compounds: (C:) transforming protein rhoa

SCOPe Domain Sequences for d4xoic_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xoic_ c.37.1.8 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
irkklvivgdgacgktcllivnskdqfpevyvptvfenyvadievdgkqvelalwdtagl
edydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkdlrn
dehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraalq

SCOPe Domain Coordinates for d4xoic_:

Click to download the PDB-style file with coordinates for d4xoic_.
(The format of our PDB-style files is described here.)

Timeline for d4xoic_: