Lineage for d1c5fe_ (1c5f E:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2073956Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 2073957Superfamily b.62.1: Cyclophilin-like [50891] (5 families) (S)
  5. 2073958Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
    automatically mapped to Pfam PF00160
  6. 2073959Protein Cyclophilin (eukaryotic) [50893] (13 species)
  7. 2074161Species Nematode (Brugia malayi) [TaxId:6279] [50898] (3 PDB entries)
  8. 2074166Domain d1c5fe_: 1c5f E: [27499]

Details for d1c5fe_

PDB Entry: 1c5f (more details), 2.47 Å

PDB Description: crystal structure of the cyclophilin-like domain from brugia malayi complexed with cyclosporin a
PDB Compounds: (E:) peptidyl-prolyl cis-trans isomerase 1

SCOPe Domain Sequences for d1c5fe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c5fe_ b.62.1.1 (E:) Cyclophilin (eukaryotic) {Nematode (Brugia malayi) [TaxId: 6279]}
kdrrrvfldvtidgnlagrivmelyndiaprtcnnflmlctgmagtgkisgkplhykgst
fhrviknfmiqggdftkgdgtggesiyggmfddeefvmkhdepfvvsmankgpntngsqf
fitttpaphlnnihvvfgkvvsgqevvtkieylktnsknrpladvvilncgelv

SCOPe Domain Coordinates for d1c5fe_:

Click to download the PDB-style file with coordinates for d1c5fe_.
(The format of our PDB-style files is described here.)

Timeline for d1c5fe_: